PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn272561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 392aa    MW: 44137.5 Da    PI: 5.2348
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn272561genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.8e-50171441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv++yLk+k+ +k++++ e++ e+d+yk+ePw+L   +++k+++ e+yfFs+ d+ky +g+r nrat +gyWkatgkd++v + kg
  Achn272561  17 LAPGFRFHPTDEELVQYYLKRKACAKPFRF-EAVLEIDVYKSEPWELAghSRLKSRDLEYYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRSVRH-KG 113
                 579*************************99.88**************85347888888**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g+kktLvf+ grap+g++t+Wvmheyrl
  Achn272561 114 QTIGMKKTLVFHGGRAPDGKRTNWVMHEYRL 144
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-6013167IPR003441NAC domain
PROSITE profilePS5100556.52417167IPR003441NAC domain
PfamPF023651.2E-2719144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAHELAAIVP SPPPTSLAPG FRFHPTDEEL VQYYLKRKAC AKPFRFEAVL EIDVYKSEPW  60
ELAGHSRLKS RDLEYYFFSP VDRKYGNGSR LNRATGKGYW KATGKDRSVR HKGQTIGMKK  120
TLVFHGGRAP DGKRTNWVMH EYRLADRDLE RDGVTQDAFV LCRIFQKSGL GPPNADRYAP  180
FIEEEWNDDV PMVIPGEEEP GYEMVNADDS QVEGNDFEQD THSHNMAALY QTELPNGCQN  240
VPFFCKRETS GYAPFPCTVD AEPISVVPNK KSRLDDPNSS NANGSEDSTT TTHDLCTTNT  300
SSALVEIPLL ESLDPKENHS NKLTAFDSAT LEKSVPPGYL KFINNLENEI LNVSMERETL  360
KIEVMRAQAM INVLQSRIEL LNKENEDLKR G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-501616719168NAC domain-containing protein 19
3swp_C2e-501616719168NAC domain-containing protein 19
3swp_B2e-501616719168NAC domain-containing protein 19
3swp_A2e-501616719168NAC domain-containing protein 19
3swm_D2e-501616719168NAC domain-containing protein 19
3swm_C2e-501616719168NAC domain-containing protein 19
3swm_B2e-501616719168NAC domain-containing protein 19
3swm_A2e-501616719168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619467.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-108NAC domain containing protein 50